General Information

  • ID:  hor006301
  • Uniprot ID:  Q805D4
  • Protein name:  C-type natriuretic peptide 3
  • Gene name:  cnp-3
  • Organism:  Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)
  • Family:  Natriuretic peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Takifugu (genus), Tetraodontidae (family), Tetradontoidea (superfamily), Tetraodontoidei (suborder), Tetraodontiformes (order), Eupercaria , Percomorphaceae , Euacanthomorphacea , Acanthomorphata , Ctenosquamata , Eurypterygia , Neoteleostei , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GGLRSCFGVRLARIGSFSGLGC
  • Length:  22
  • Propeptide:  MSLNLPGYALFFILLVASSGAKPAPDLQILEPPLSSLEEQEEMQEEVQEKVQEQQEEVQEKVQEQQEEVQEQQEEVQEQQEEQQEEVQERGRGTGDVLLRAQLDSSTWALQKDDVLMRLFKDLLRTSKRSRSRYKKGGLRSCFGVRLARIGSFSGLGC
  • Signal peptide:  MSLNLPGYALFFILLVASSGA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exhibits natriuretic and vasodepressant activity. Has cGMP-stimulating activity. May help to regulate body fluid homeostasis in a variety of aquatic environments.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-22
  • Structure ID:  AF-Q805D4-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006301_AF2.pdbhor006301_ESM.pdb

Physical Information

Mass: 258836 Formula: C95H157N31O26S2
Absent amino acids: DEHKMNPQTWY Common amino acids: G
pI: 10.52 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: 64.55 Boman Index: -1527
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 88.64
Instability Index: 5870 Extinction Coefficient cystines: 125
Absorbance 280nm: 5.95

Literature

  • PubMed ID:  12893874
  • Title:  Four functionally distinct C-type natriuretic peptides found in fish reveal evolutionary history of the natriuretic peptide system.